NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116226_10093038

Scaffold Ga0116226_10093038


Overview

Basic Information
Taxon OID3300009787 Open in IMG/M
Scaffold IDGa0116226_10093038 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3108
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053738Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0116226_100930381F053738N/AMESNDDEKYKHLEGDDGIMGFDGFMSMEQSNLPMSAIVRSNDTINSSNLMERARAQLVTTMQEITNECKEGNVTFYEHATSHMRVLACNIHNIHLTKAHAVLHSGLVSHYVEHGLGNNVKQLKDWHETMLNHTNVCTKQCYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.