Scaffold Ga0115001_10250487

Overview

Basic Information

• Taxon OID: 3300009785
• Scaffold ID: Ga0115001_10250487
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1134
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 77.0991
  • Long. (^o): -150.2252
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054920	Metagenome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0115001_102504874	F054920	N/A	CTKDMNEGFSVFTKQTRVKEHYKKMADTGVEFYTCDDDDLDKEYGMYYGNLEFDPLDIMETNSGHTKMFYKENGKWQQL*