Scaffold Ga0123357_10338415

Overview

Basic Information

• Taxon OID: 3300009784
• Scaffold ID: Ga0123357_10338415
• Source Dataset Name: Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1459
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Petit - Saut dam, French Guiana
• Coordinates
  • Lat. (^o): 5.0626
  • Long. (^o): -53.0462

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000429	Metagenome	1149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123357_103384152	F000429	AGGAG	MKGKGKGKAVPLQAWIGPEGSWKLRYPDFITTAQDGGNVVSLTHRPPLPPGNAPGTHFC*