NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116164_10075797

Scaffold Ga0116164_10075797


Overview

Basic Information
Taxon OID3300009775 Open in IMG/M
Scaffold IDGa0116164_10075797 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1653
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101357Metagenome / Metatranscriptome102N
F105375Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0116164_100757971F101357AGGMNLNNITTALKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIHNPDSLDKPFIQLSATFTSEFDIQEYNEWLRANQYKLYPLLLDILKISLKDNFYNYSNASNIHYEG
Ga0116164_100757974F105375N/AMKNNETFQTTQHLDKLVTNLGLQIQELFSLDLEEILDYSNNLMNLLVNAYVENQCLALSAMISKQDGFAIYSFLFQTPDTSKGAADALVNFAMNFTDGEANIKSINRISSNIMQITFTV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.