Scaffold Ga0116177_10030367

Overview

Basic Information

• Taxon OID: 3300009696
• Scaffold ID: Ga0116177_10030367
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3466
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.84
  • Long. (^o): -87.68

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060093	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116177_100303673	F060093	GAGG	MATSASYINNGTALKINGEAGADVAWSMEGISNGAGRVSAQFDLGAAPRPNRFKWICEAQFQATPTQGRGLELYVAEALDNASSRMSGDVGTTDAALGDVDMRRNLKGIGYVVSENAAASEKCIAFGEFTTSARYLNMVGYNDAGATTNATDSNFVFYLQPVFDEGQ*