Scaffold Ga0116171_10001186

Overview

Basic Information

• Taxon OID: 3300009692
• Scaffold ID: Ga0116171_10001186
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 26407
• Total Scaffold Genes: 27
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (48.15%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 35.92
  • Long. (^o): 139.63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059489	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116171_100011862	F059489	GGAG	MQRNDLDSYILRNSRFKFFIFDRREIRTIADNLEFKTGRVRTELRKLGYRLIKNSHGQMVWKRECLLP*