Scaffold Ga0116176_10412778

Overview

Basic Information

• Taxon OID: 3300009688
• Scaffold ID: Ga0116176_10412778
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 658
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.84
  • Long. (^o): -87.68

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043478	Metagenome / Metatranscriptome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116176_104127781	F043478	N/A	KKEVSAMDPYDGHSAWKFQYSHPAGTGVKGRRISLLSWLANLIFLSGTLLFAYQLYGWFEYNEWTRYPSIALVKYVPAGAFGFLNEAAGVKAFAMWILDRADLSVLLILMGFFTAKFLVDSE*