NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123335_1411601

Scaffold Ga0123335_1411601


Overview

Basic Information
Taxon OID3300009680 Open in IMG/M
Scaffold IDGa0123335_1411601 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)621
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080092Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0123335_14116011F080092N/APVWKMKYIAAVFTALLFCLIICSLPSHAVISSTMYSNGGSIVVNTDEFWETSNNLMRFGTVNDSYQYGGKSQTIVSLGRTGIMKQDSTKVETLGMLNAFDSAGMFATQTNIPESICDQSNFIAGYGNQSSSRYPETQTVEGLWGLMGSGPGTTYESQIEVVGTVVGVSVQGTSPQGYLYEDVKGSLKAGLDKNSSALQYSYSRHDH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.