Scaffold Ga0123334_1266740

Overview

Basic Information

• Taxon OID: 3300009671
• Scaffold ID: Ga0123334_1266740
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 755
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: Washington, USA
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058559	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123334_12667402	F058559	N/A	MNEFMYYVNGLYFANLKTARKHAQRVGDSDVLLTLGDYDETILSYNPMSERLERIQSVNEAKEKLLREYGSKQFIK*