Scaffold Ga0116148_1002957

Overview

Basic Information

• Taxon OID: 3300009669
• Scaffold ID: Ga0116148_1002957
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16144
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.53
  • Long. (^o): -90.43

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045183	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116148_100295716	F045183	GGA	MRLARAAELQVEASTMKIKETLKQRFNRLMHPALRENEIIKTLSGLPGVRPFLYEFKLGPLFLISAWLFLFHANYTGAAEDWLLYFFGGCAVVGVLSVHKAVMRFLYRIAQFEKPVEGQDRTIMITAETVTLLGFLTAAMLFLNEFQSTGFGM*