Scaffold Ga0116182_1381477

Overview

Basic Information

• Taxon OID: 3300009666
• Scaffold ID: Ga0116182_1381477
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 559
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin133 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA, Massachusetts, Boston
• Coordinates
  • Lat. (^o): 42.35
  • Long. (^o): -70.96

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023605	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116182_13814772	F023605	N/A	PKMKRIIGDHRSEYAVIDNTDDKRLDKYLRISEADYLRIKRWHYLYNEFGMASTVREIILFFYNGVAKYGLEGFLEIVGKKLKIDKLKNDFLGKMTQLLNITARKQLLYALIIENYPKYAYST*