Scaffold Ga0116190_1212313

Overview

Basic Information

• Taxon OID: 3300009655
• Scaffold ID: Ga0116190_1212313
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium GWB1_27_13 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 34.65
  • Long. (^o): 135.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053725	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116190_12123131	F053725	N/A	IHADLNFFSMGCLLRRIILLFLEEYEKLGITRVEIKCSIITLKLFLRLTKMKKWNKSRELSHFSGNLKPFYKAIYNDCYQVVGFETYY*