Scaffold Ga0116106_1047546

Overview

Basic Information

• Taxon OID: 3300009645
• Scaffold ID: Ga0116106_1047546
• Source Dataset Name: Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1437
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828
  • Depth (m): .4 to .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009127	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116106_10475464	F009127	N/A	YNILWALVFGFATLNILSLGARRFEQGQDRGGLNFGETLAILVVVVSIVLLGWEMLYLFHILPIRLTPR*