NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105173_1054237

Scaffold Ga0105173_1054237


Overview

Basic Information
Taxon OID3300009622 Open in IMG/M
Scaffold IDGa0105173_1054237 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)681
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)-24.9939Long. (o)-35.9974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027540Metagenome / Metatranscriptome194Y
F030781Metagenome / Metatranscriptome184N

Sequences

Protein IDFamilyRBSSequence
Ga0105173_10542371F027540GAGGMSSFKPALIKPVYDVSNFGEDVTLPLNCLSGSTVTLTPSTATFVQVLEDSKVPIDQVDLFITDSDKMAMIHAGNDTDFDKTWEWSVDMSNQAYQISLNFAVGMKVSAYTSGNFKISDVQVIIKQIGGGEGDHVYLNKIIDPGMTN
Ga0105173_10542372F030781N/ATFSSNDFGNSLPLKVAMQPGACGLAGTTTPGNLALASYHNTHMPMKTSCKISTSFTNDVAQSATSRFIMGVGYTKQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.