Scaffold Ga0105236_1045951

Overview

Basic Information

• Taxon OID: 3300009619
• Scaffold ID: Ga0105236_1045951
• Source Dataset Name: Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 572
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): 9.7046
  • Long. (^o): -55.3027

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096070	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105236_10459512	F096070	N/A	MKEKAIDLLEEYGDLVDIYYTQFLEVSFFLKVPASYPMVLAFLKKKIPNLTEQELSFLVSEITSAYHDDI*