Scaffold Ga0105340_1271384

Overview

Basic Information

• Taxon OID: 3300009610
• Scaffold ID: Ga0105340_1271384
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 732
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9232
  • Long. (^o): -106.9519
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094823	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105340_12713841	F094823	N/A	MARGEWRHVVTLQNPGPAGTWIDLDPATWYVSLSQLTGDDIGVFIEPVAGTPISSATYAVRGDFHPGVTTKTRMVFGSQTFAITSVEDVDMRGVE