Scaffold Ga0114906_1049673

Overview

Basic Information

• Taxon OID: 3300009605
• Scaffold ID: Ga0114906_1049673
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1600
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.38
  • Long. (^o): 4.65
  • Depth (m): 2720

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016734	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114906_10496734	F016734	N/A	MSNKQQKKTEAALDKMDLTDSQRDAFDHTPKRSVINLDTYQNTDTFSLQGYNLCKVMDDIVLAQFVDLSEDGRSVIRNGIHIPLAQVQRTWRLAKVILIGPEVKYTKPGDIVCFPDDKGIKVDNMSIKGYDKPLRDCLFLNEQRFFGICEELESDDHQLRKS*