NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114901_1216486

Scaffold Ga0114901_1216486


Overview

Basic Information
Taxon OID3300009604 Open in IMG/M
Scaffold IDGa0114901_1216486 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)548
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)7.24Alt. (m)Depth (m)2766
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002078Metagenome / Metatranscriptome596Y
F046426Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0114901_12164861F002078N/AIAGEIVLMFTVITGALPDRWVQKVPILGTMWPMFNWLAGNIFNNINHPKGMAAKVEVEKEIDEAKAKVRDRVGMPDVLAGM*
Ga0114901_12164862F046426GGAMEVVAPVANFAIGFYDHDDYYSKECLWYDEVKLNEETKKWFMENNPPEVVSKDLATVSRNNDIYKEVCEEEKGILDKLEDKVERLIDEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.