Scaffold Ga0114901_1036444

Overview

Basic Information

• Taxon OID: 3300009604
• Scaffold ID: Ga0114901_1036444
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1782
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 39.48
  • Long. (^o): 7.24
  • Depth (m): 2766

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038864	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114901_10364441	F038864	AGG	MKIDKTLIVEALSLYKAELVKRDISEHDNTLDILIKVNEQIKTVKQYKQNTNTNG*