Scaffold Ga0115103_1528292

Overview

Basic Information

• Taxon OID: 3300009599
• Scaffold ID: Ga0115103_1528292
• Source Dataset Name: Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1548
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 36.754
  • Long. (^o): -122.0208
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029758	Metagenome / Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115103_15282926	F029758	N/A	MIANDRLNAVEHIWYPESDRWIYIERYASGYLGLNCMQGDEYEYFKKNWCEIDRGMSEFYSTMKNDLLKLRVEMSELEFIDKVMWIYFESKINIERYK*