Scaffold Ga0105214_100246

Overview

Basic Information

• Taxon OID: 3300009595
• Scaffold ID: Ga0105214_100246
• Source Dataset Name: Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1994
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): 1.4995
  • Long. (^o): -36.9978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037766	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105214_1002462	F037766	N/A	VETEMIRRATLEILQDGEKVFGSPTGGKYFVQEFENDEPRGGSFFKTIQEAEKHMVEYENGDESEPQFLSE*