Scaffold Ga0115101_1702984

Overview

Basic Information

• Taxon OID: 3300009592
• Scaffold ID: Ga0115101_1702984
• Source Dataset Name: Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1115
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 36.746
  • Long. (^o): -122.0257
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025045	Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115101_17029841	F025045	N/A	VNGTRKKRDVMGEDDEPSSNMIERFQDIYMSVLESEQCMERIVCEIGGLAEDAGLDKKMTKSLEMFAPKKYQKMMKTFNHGKDCKKNNKCGYF*