NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116233_1168420

Scaffold Ga0116233_1168420


Overview

Basic Information
Taxon OID3300009589 Open in IMG/M
Scaffold IDGa0116233_1168420 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018746Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0116233_11684202F018746GGAGMRPTSETLNDFEAAVLAALEQTPEKTVLAADLVREFSTRAGRTSCISRLERMERRGLVRTSRFAGRILVHHPPAEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.