Scaffold Ga0130025_1156790

Overview

Basic Information

• Taxon OID: 3300009566
• Scaffold ID: Ga0130025_1156790
• Source Dataset Name: Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Colorado
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 798
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids → Methanogenic O-Xylene Degrading Microbial Communities From Aquifer Solids In Pensacola, Florida - Enrichment Culture X8-Ab

Source Dataset Sampling Location

• Location Name: Pensacola, Florida
• Coordinates
  • Lat. (^o): 30.703611
  • Long. (^o): -87.369167
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063304	Metagenome	129	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0130025_11567901	F063304	N/A	MRLNNSTPDRAVSPHIYNLLDQRLAQQGAPLHQLIRTYAAAVPAQPASPEELLNQLTAVLGKWAADPAQRVKPETALAEEHLRLMDDINKIQGPEGASRLEATLVRVVANQFARNMGSALRIPDESKLICLSDVKPGNAYSAFAQRTALIGIQPHEWVKRWVESQRDLFRNKPSDAGYLRLAQRLSGAWPLESGNDAFQRALASFLDGIATSTSQSH