 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009566 Open in IMG/M |
| Scaffold ID | Ga0130025_1026904 Open in IMG/M |
| Source Dataset Name | Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Colorado |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 536 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids → Methanogenic O-Xylene Degrading Microbial Communities From Aquifer Solids In Pensacola, Florida - Enrichment Culture X8-Ab |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pensacola, Florida | |||||||
| Coordinates | Lat. (o) | 30.703611 | Long. (o) | -87.369167 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102362 | Metagenome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0130025_10269041 | F102362 | N/A | MNTTTPPATRPLNDAAIATTQRAVSQTLGGLLSPLEARLAKGFQSHRDKPLVRPFCNIFERHLKVELDQQNFIWSDTLRLNARLIQAIEAAAISEDEKNEAVFWLVLFYTSYFALGYQTRCLKAPAEQQPLLNLAQTQAVLHHMRSLGIQQPANAPNWEQKG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |