Scaffold Ga0130025_1014930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130025_1014930

Scaffold Ga0130025_1014930

Overview

Basic Information
Taxon OID	3300009566 Open in IMG/M
Scaffold ID	Ga0130025_1014930 Open in IMG/M
Source Dataset Name	Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8651
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (61.54%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids → Methanogenic O-Xylene Degrading Microbial Communities From Aquifer Solids In Pensacola, Florida - Enrichment Culture X8-Ab

Source Dataset Sampling Location
Location Name	Pensacola, Florida
Coordinates	Lat. (^o)	30.703611	Long. (^o)	-87.369167	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098547	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130025_10149309	F098547	GGAG	MRQILLFISLAVLCFGLYLKLFYDVPDSQEKINFFVSGFFIIIGISSLLMNLLWDTKKRKNRE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.