Scaffold Ga0116234_1121432

Overview

Basic Information

• Taxon OID: 3300009542
• Scaffold ID: Ga0116234_1121432
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10565
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066219	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116234_11214325	F066219	GGAGG	MKKVFLVFLILCIGCLIHANIVEFFEEIPPVVKYAVGTVITIYGLSWAYSWFFDPIIVVADTTYGAFNFGPFIVVSPYFWYDASESSRNTVINHEYVHYVQHAIYGPILSLTYPICSWYSTIKTGNQWDANYWELQAIELSDISSPAWEPSFVIELE*