Scaffold Ga0129287_10000357

Overview

Basic Information

• Taxon OID: 3300009538
• Scaffold ID: Ga0129287_10000357
• Source Dataset Name: Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 32922
• Total Scaffold Genes: 40
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 23 (57.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location

• Location Name: Cape Shores, Lewes, Delaware, USA
• Coordinates
  • Lat. (^o): 38.7855
  • Long. (^o): -75.1045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098547	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129287_1000035730	F098547	N/A	MGEQMRQVFLFVSLAIIGIGLYLKFFYDVPDNQATINFFTSWFFIIVGTSNLLINLFWSSPKNKKFNKQSE*