Scaffold Ga0129360_1015850

Overview

Basic Information

• Taxon OID: 3300009532
• Scaffold ID: Ga0129360_1015850
• Source Dataset Name: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, Depth 3m; RNA IDBA-UD
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 566
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location

• Location Name: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.548517
  • Long. (^o): -70.622961
  • Depth (m): 3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098577	Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129360_10158501	F098577	N/A	LKAGIEKAAVLISKLTDRILELEEDVGRWKKDKKSATTVRDAEKMDFTATVRDYTESIDALREAISVLKKQAYDRKQAALIQSSLIQVRSLKLVPVATKRALTNFLQQDPELEYQAPEANAYEFQSGGVVDMLEKLNDEFSSKRTDLEKEELGAQQSFEQIMQQLADNIENAEFEISKKTKFRAQTQQ