Scaffold Ga0114920_10269461

Overview

Basic Information

• Taxon OID: 3300009528
• Scaffold ID: Ga0114920_10269461
• Source Dataset Name: Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1144
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S7086C20 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: South Pacific Ocean
• Coordinates
  • Lat. (^o): -44.283
  • Long. (^o): -75.865
  • Depth (m): 3285

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048391	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114920_102694611	F048391	AGAAGG	MNDDKSVGPINNLDYLEELLNEGYIIKGPRKDSSRDLTSFKAFLKKGKEFAPEDWLSSMGYEFVEPSTFTKGHRLAYKIIDEFPDQRFNSNYSLVKGKREIPLYLKTEVPAS*