NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116225_1359149

Scaffold Ga0116225_1359149


Overview

Basic Information
Taxon OID3300009524 Open in IMG/M
Scaffold IDGa0116225_1359149 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)648
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005822Metagenome / Metatranscriptome389Y
F072644Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0116225_13591491F005822N/ATHPASEGRKSRAVTDSKPTLPRNTATRRRRNRQDNSETSGEERFFLAGESSDGAVPALGRECGSEAEAIIDAFRERVNFYRLSEFQTRADVGPSGEPILRKDGLRKNNPAS*
Ga0116225_13591492F072644N/AMETSVSLKHPNFLGFCCSVRGSATSLAVKKEKLMSERNQVVVVLIVALLLGAFVDRSTALKIVGGVALLWTQQNQPTVFECIRKLLSLRRKGLSVREYRGGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.