Scaffold Ga0116230_10054134

Overview

Basic Information

• Taxon OID: 3300009510
• Scaffold ID: Ga0116230_10054134
• Source Dataset Name: Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3652
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093390	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116230_100541345	F093390	GGA	MSIKSFIEAPLQAKTSVSRVFWLYGIVGSLLYSGLEFLIDPGSAWLLRAYTLGGALLSLYVIVGTYRCAVNCRSAGMARFVRVSCVISVLLLPVITYLELSGALSTDLSQLQQLGL*