Scaffold Ga0123573_10411386

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123573_10411386

Scaffold Ga0123573_10411386

Overview

Basic Information
Taxon OID	3300009509 Open in IMG/M
Scaffold ID	Ga0123573_10411386 Open in IMG/M
Source Dataset Name	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Novogene Bioinformatics Technology Co., Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1296
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location Name	Mai Po Marshes at Hong Kong
Coordinates	Lat. (^o)	22.498889	Long. (^o)	114.045833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038247	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123573_104113862	F038247	N/A	MKSVFFWSEEEARLHRAQNPEPRGIYLTLRQGAIIVKPAQSILFGFTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.