NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118657_12708012

Scaffold Ga0118657_12708012


Overview

Basic Information
Taxon OID3300009506 Open in IMG/M
Scaffold IDGa0118657_12708012 Open in IMG/M
Source Dataset NameMangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNovogene
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)554
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location NameMai Po Nature Reserve Marshes in Hong Kong
CoordinatesLat. (o)22.498889Long. (o)114.045833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056563Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0118657_127080122F056563N/AVALSSGTTMAPESDPRPAVVQIGQQLADAFKKLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.