Scaffold Ga0118657_10130550

Overview

Basic Information

• Taxon OID: 3300009506
• Scaffold ID: Ga0118657_10130550
• Source Dataset Name: Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Novogene
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4351
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location

• Location Name: Mai Po Nature Reserve Marshes in Hong Kong
• Coordinates
  • Lat. (^o): 22.498889
  • Long. (^o): 114.045833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009657	Metagenome / Metatranscriptome	315	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118657_101305504	F009657	N/A	MEVIEIKEYEILYDTGDARNLVAQINRMAKEGWKPKSIGGLGNPAGLHAVYVLMEREVV*