Scaffold Ga0118657_10078375

Overview

Basic Information

• Taxon OID: 3300009506
• Scaffold ID: Ga0118657_10078375
• Source Dataset Name: Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Novogene
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5537
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Thermanaerothrix → Thermanaerothrix daxensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location

• Location Name: Mai Po Nature Reserve Marshes in Hong Kong
• Coordinates
  • Lat. (^o): 22.498889
  • Long. (^o): 114.045833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018837	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118657_100783753	F018837	AGGAG	MSTIFEELRKNYGAASAEQKLHILRRELLRPIVTVDTSAQLLQSASDSICECLSEDISADEFRNTVQWLMEAARDLHQILDALTEDTSKVPDQYGNG*