Scaffold Ga0115569_10082710

Overview

Basic Information

• Taxon OID: 3300009497
• Scaffold ID: Ga0115569_10082710
• Source Dataset Name: Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1664
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Germany:Helgoland, sampling site Kabeltonne, North Sea
• Coordinates
  • Lat. (^o): 54.1883
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082731	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115569_100827102	F082731	GAG	MQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHM*