Basic Information | |
---|---|
Taxon OID | 3300009492 Open in IMG/M |
Scaffold ID | Ga0127412_10044875 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 541 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | US Atlantic Margin | |||||||
Coordinates | Lat. (o) | 37.5409 | Long. (o) | -74.10211667 | Alt. (m) | Depth (m) | .06 to .08 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081227 | Metagenome / Metatranscriptome | 114 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0127412_100448752 | F081227 | N/A | VLVLQELFDRKLHEASEMSTEELASELKGSVSNNNGMMSRDTMIEIVAMKLSNEELESMQ |
⦗Top⦘ |