Scaffold Ga0127412_10019503

Overview

Basic Information

• Taxon OID: 3300009492
• Scaffold ID: Ga0127412_10019503
• Source Dataset Name: Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 715
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: US Atlantic Margin
• Coordinates
  • Lat. (^o): 37.5409
  • Long. (^o): -74.10211667
  • Depth (m): .06 to .08

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036198	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127412_100195032	F036198	GAGG	MTDHKIEEIRQKYMEWLYQRSGRTCGTYTGLYQERLKELVQRDMQEVA*