Scaffold Ga0127412_10014900

Overview

Basic Information

• Taxon OID: 3300009492
• Scaffold ID: Ga0127412_10014900
• Source Dataset Name: Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 789
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: US Atlantic Margin
• Coordinates
  • Lat. (^o): 37.5409
  • Long. (^o): -74.10211667
  • Depth (m): .06 to .08

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005940	Metagenome / Metatranscriptome	386	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0127412_100149001	F005940	N/A	PELLSFAVRGFQLVNDLVVDMPINISDQIERPFRKALRVNGQGELIYQALRNKEGQNVQLEIFRPDTLLRGIIENVSSPVEEISPRGSVTTYCLVRFRGSKVISTSSSGEGLGIGLLGVKRLG*