Scaffold Ga0114932_10629652

Overview

Basic Information

• Taxon OID: 3300009481
• Scaffold ID: Ga0114932_10629652
• Source Dataset Name: Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 627
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kolumbo volcano, Aegean Sea
• Coordinates
  • Lat. (^o): 36.5264
  • Long. (^o): 25.4868
  • Depth (m): 470

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030891	Metagenome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114932_106296522	F030891	N/A	MTDYKKLIDNLEKCTKQELVEKLTLKNAELLTCEKEVDRLNEYVQIMELERGAKEKI*