Scaffold Ga0128062_101373

Overview

Basic Information

• Taxon OID: 3300009452
• Scaffold ID: Ga0128062_101373
• Source Dataset Name: Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is 06june2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1004
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090511	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0128062_1013731	F090511	N/A	MLYPFKRKILQRMGLNHVAYHGNKNCNEDWLNGYFQAKKDLEMQLNQIRITTDDLD*