NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114945_10009187

Scaffold Ga0114945_10009187


Overview

Basic Information
Taxon OID3300009444 Open in IMG/M
Scaffold IDGa0114945_10009187 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5308
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameBeatty, NV
CoordinatesLat. (o)36.96Long. (o)-116.72Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013869Metagenome / Metatranscriptome267Y
F021438Metagenome / Metatranscriptome219Y
F046231Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0114945_100091874F013869GGGGGMTIEKVLAVYKTSPIVLVVESAEGTVLELSLTDLHEAGHRLSDDACTSLSEVYQMFTCQSVAG*
Ga0114945_100091876F021438AGGAGGMSTAETPTQLRLTRDLLERADALIEVMAADPEVRALGMPTRTAVLRLAIARGLKDLERQYQPQTPAHAAPPHPTTATNASTRRPREGTLSHVYAGRDGEGHEEGSPRDR*
Ga0114945_100091877F046231AGGAMRRGGALAERICMKTGRSQPSIVIDAQELVAHGDRVACMEREMGNPPRVIHGPDVCYLFHARDQEVLPGFVERWHSLGIEAQVVVIQPTGGEEAHARISVRDW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.