Scaffold Ga0115005_10911614

Overview

Basic Information

• Taxon OID: 3300009432
• Scaffold ID: Ga0115005_10911614
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 709
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 79.0225
  • Long. (^o): -9.5247
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054345	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115005_109116141	F054345	N/A	HNLTKIDPDITYSLWDSFIQYILAAPTKTFFTRLNWSSISELTSSQYHSDTADFSKHNAGATNKFSKPLFILKQVKTVPNGRLLLLSFACRSKKIREEQKKNETPQLKRIIFYSRGLLSEVWGRR*