Scaffold Ga0114955_1087251

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114955_1087251

Scaffold Ga0114955_1087251

Overview

Basic Information
Taxon OID	3300009410 Open in IMG/M
Scaffold ID	Ga0114955_1087251 Open in IMG/M
Source Dataset Name	Marine algal microbial communities from Porto, Portugal - Porto_5 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	624
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location Name	Portugal: Porto
Coordinates	Lat. (^o)	41.162	Long. (^o)	-8.622	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074327	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114955_10872511	F074327	N/A	MSEFMRILMATGEAKSREEHAALREDLCAHVFAQLGEFLEPYLD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.