Scaffold Ga0103809_1024899

Overview

Basic Information

• Taxon OID: 3300009388
• Scaffold ID: Ga0103809_1024899
• Source Dataset Name: Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, San Diego
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 869
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Metatranscriptome Sequencing Of An Anaerobic Hexadecane-degrading Microbial Consortia From University Of California, San Diego, Usa

Source Dataset Sampling Location

• Location Name: UCSD, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072488	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103809_10248992	F072488	AGGAGG	MKSPALDPQLAWALWYELAKWSFLLWECYQEDFLRLAEEEKAKRGKDPEEEFEIEIPF*