Scaffold Ga0118737_1098007

Overview

Basic Information

• Taxon OID: 3300009379
• Scaffold ID: Ga0118737_1098007
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 1 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 591
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Baltimore Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 38.05018333
  • Long. (^o): -73.82193333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037736	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118737_10980071	F037736	N/A	VPCRVQLDGLQILWLLANPLWTHGIGESGSKTITGWLLMGAAAANHIWWLNTNPFTGLLLHLNSYRIRHLPFGFLTAS*