Scaffold Ga0118726_1047734

Overview

Basic Information

• Taxon OID: 3300009378
• Scaffold ID: Ga0118726_1047734
• Source Dataset Name: Combined Assembly of Gp0137076, Gp0137077
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1952
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094922	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118726_10477344	F094922	GAGG	MDERSCAEMETILKVHRQRIDDLEKTLTDINTQLIQIKACVYGAVGYAIATQLGILEVIKL*