Scaffold Ga0118716_1053756

Overview

Basic Information

• Taxon OID: 3300009370
• Scaffold ID: Ga0118716_1053756
• Source Dataset Name: Combined Assembly of Gp0127930, Gp0127931
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2403
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012162	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118716_10537561	F012162	AGGAG	MLLSGEQTKSYLDEMIQHYGEKENNTSGHFSWERSEASYRRKAFEDMKMVLFGDDDNESK