Scaffold Ga0116588_1153054

Overview

Basic Information

• Taxon OID: 3300009304
• Scaffold ID: Ga0116588_1153054
• Source Dataset Name: Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 SPAdes
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Liverpool
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location

• Location Name: United Kingdom
• Coordinates
  • Lat. (^o): 54.9632021
  • Long. (^o): -1.6348029

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036103	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116588_11530542	F036103	N/A	MEKRKMKLQKNQIRILGVASCLIGAFLMAFGEQIIVVYHTEVARVIGILGIGLITTGNKTSLVGKKKEVL*